PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10002028
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 180aa    MW: 19368.3 Da    PI: 8.4904
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10002028genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1482.7e-1587147161
                  XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                  +ke kr +r+ +NR++A+  R+RKka++ eLe +vk +e++N++L ++l++l++e + l++
  Lus10002028  87 DKENKRLKRLLRNRVSAQQARERKKAYLSELEVRVKDMEKKNSELEERLSTLQNENQMLRQ 147
                  5899****************************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.0E-1387151IPR004827Basic-leucine zipper domain
PfamPF001707.8E-1488147IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.25489152IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.38E-1391148No hitNo description
Gene3DG3DSA:1.20.5.1702.2E-1691150No hitNo description
CDDcd147041.92E-1792143No hitNo description
PROSITE patternPS00036094109IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MQEQATSSAA ANSLPSSSER SSSSALQLEV KEGMESDDEI RRVPEMGGEP AGTSGSGRNA  60
AATVGKDRGG HQGSGEGTRK RGRSPADKEN KRLKRLLRNR VSAQQARERK KAYLSELEVR  120
VKDMEKKNSE LEERLSTLQN ENQMLRQVTM QAVGVEGQNC GGGGSMAANE NERDEAVSF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2oqq_A2e-14112148339Transcription factor HY5
2oqq_B2e-14112148339Transcription factor HY5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002515537.13e-70PREDICTED: transcription factor HY5
RefseqXP_012076602.13e-70PREDICTED: transcription factor HY5
SwissprotQ9SM509e-61HY5_SOLLC; Transcription factor HY5
TrEMBLA0A067KF353e-70A0A067KF35_JATCU; Uncharacterized protein
TrEMBLB9RP683e-70B9RP68_RICCO; Transcription factor hy5, putative
STRINGPOPTR_0018s01530.11e-68(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70643248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.17e-47bZIP family protein